MEME version 3.0 (Release date: 2002/04/02 00:11:59)
For further information on how to interpret these results or to get a copy of the MEME software please access http://meme.sdsc.edu.
This file may be used as input to the MAST algorithm for searching sequence databases for matches to groups of motifs. MAST is available for interactive use and downloading at http://meme.sdsc.edu.
If you use this program in your research, please cite:
Timothy L. Bailey and Charles Elkan, "Fitting a mixture model by expectation maximization to discover motifs in biopolymers", Proceedings of the Second International Conference on Intelligent Systems for Molecular Biology, pp. 28-36, AAAI Press, Menlo Park, California, 1994.
DATAFILE= agr3_sub.fasta ALPHABET= ACDEFGHIKLMNPQRSTVWY Sequence name Weight Length Sequence name Weight Length ------------- ------ ------ ------------- ------ ------ A.thaliana 1.0000 865 C.elegans 1.0000 729 D.melanogaster 1.0000 808 H.sapiens 1.0000 786 A.aeolicus 1.0000 692 M.thermoautotrophicum 1.0000 677 B.subtilis 1.0000 689 D.radiodaurans 1.0000 690 M.tuberculosis 1.0000 673 A.fulgidus 1.0000 642 A.pernix 1.0000 681 Hthio 1.0000 105
This information can also be useful in the event you wish to report a problem with the MEME software. command: meme agr3_sub.fasta -protein -nmotifs 10 model: mod= zoops nmotifs= 10 evt= inf object function= E-value of product of p-values width: minw= 8 maxw= 50 minic= 0.00 width: wg= 11 ws= 1 endgaps= yes nsites: minsites= 2 maxsites= 12 wnsites= 0.8 theta: prob= 1 spmap= pam spfuzz= 120 em: prior= megap b= 40185 maxiter= 50 distance= 1e-05 data: n= 8037 N= 12 sample: seed= 0 seqfrac= 1 Dirichlet mixture priors file: prior30.plib Letter frequencies in dataset: A 0.092 C 0.013 D 0.061 E 0.080 F 0.044 G 0.072 H 0.028 I 0.039 K 0.053 L 0.102 M 0.024 N 0.031 P 0.047 Q 0.032 R 0.059 S 0.062 T 0.045 V 0.059 W 0.018 Y 0.038 Background letter frequencies (from dataset with add-one prior applied): A 0.092 C 0.013 D 0.061 E 0.080 F 0.044 G 0.071 H 0.029 I 0.039 K 0.053 L 0.102 M 0.024 N 0.031 P 0.047 Q 0.032 R 0.059 S 0.062 T 0.045 V 0.059 W 0.018 Y 0.038
BL MOTIF 1 width=50 seqs=11 A.aeolicus ( 15) YLRQHAYNPVDWYPWGEEAFKKAKEEDKPIFLSIGYSTCHWCHVMEKESF 1 D.melanogaster ( 86) YLLQHAYNPVDWYPWGEEAFEKARSENKIIFLSVGYSTCHWCHVMEHESF 1 A.thaliana ( 170) YLLQHAHNPVDWYPWGEEAFEEARKRDVPIFLSIGYSTCHWCHVMEVESF 1 C.elegans ( 27) YLLQHANNPIDWYPWGQEAFQKAKDNNKPIFLSVGYSTCHWCHVMEKESF 1 H.sapiens ( 72) YLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESF 1 B.subtilis ( 17) YLLQHAHNPVDWFPWGEEAFEKAKRENKPVLVSIGYSTCHWCHVMAHESF 1 M.thermoautotrophicum ( 16) YLLQHAHNPVNWYPWGDDAFRKALAERKPIFLSIGYSTCHWCHVMARESF 1 D.radiodaurans ( 26) YLLQHQDNPVDWWPWSPEAFAEARQRDVPVLLSVGYSTCHWCHVMAHESF 1 A.pernix ( 13) YLRQHSCDPVDWMPWGAEAFEKARRLDKPVFVSVGYSSCHWCHVMQRESF 1 A.fulgidus ( 12) YLRKAANQPVEWFEWGEEAFAKAKKEDKPILLSIGGVWCHWCHVMAKESF 1 M.tuberculosis ( 19) YLRQHADNPVHWQQWTPQALAEAAARAVPILLSVGYAACHWCHVMAHESF 1 //
log-odds matrix: alength= 20 w= 50 n= 7449 bayes= 9.29983 E= 7.7e-351 -629 -449 -625 -694 -206 -567 -359 -500 -600 -514 -501 -484 -573 -506 -576 -554 -548 -544 -305 466 -458 -330 -584 -554 -253 -540 -465 -136 -481 318 -111 -465 -478 -381 -468 -473 -379 -241 -419 -408 -440 -354 -560 -493 -281 -507 -396 -178 -222 257 -165 -387 -499 -291 242 -435 -370 -281 -424 -380 -295 -256 -368 -160 -422 -423 -47 -306 -77 -296 -165 -181 -317 468 -200 -269 -258 -338 -338 -404 -73 -243 -310 -377 -278 -373 481 -377 -367 -371 -282 -78 -372 -62 -233 -240 -258 -360 -312 -123 303 -42 -378 -361 -327 -182 -356 -231 -314 -313 -218 -265 -395 28 -342 27 -160 -125 -372 -381 -307 226 126 -246 -203 -247 335 -354 -217 -391 -315 229 -335 -118 -262 -158 -203 -362 -327 245 -390 -258 -142 -426 -376 -348 -109 -262 -288 -421 -321 476 -370 -94 -351 -151 -211 -348 -355 -358 -362 -395 -470 -485 -520 -456 -448 -454 -414 -499 -474 -410 434 -371 -458 -356 -368 -453 -559 -549 -198 -152 -439 -430 -318 -450 -384 132 -387 -227 -200 -356 -388 -368 -391 -356 -175 374 -470 -448 -352 -310 380 -91 -421 -370 -97 -347 -361 -448 -370 24 -444 -295 -393 -295 -330 -366 -425 -384 -450 -294 -445 -471 -164 -438 -391 -364 -401 -295 -304 -346 -455 -339 -391 -407 -379 -363 569 -196 -214 -135 -297 -291 192 -328 -8 -160 -239 -213 82 -191 -289 39 -258 -180 -205 -192 130 374 -195 -266 -307 -68 -379 -332 -302 -291 -244 -342 -310 -252 404 57 -301 -192 -206 -289 -458 -423 -450 -294 -445 -471 -164 -438 -391 -364 -401 -295 -304 -346 -455 -339 -391 -407 -379 -363 569 -196 -224 -266 -293 -380 -462 356 -354 -398 -315 -507 -379 -182 -387 -330 -342 -52 -37 -377 -417 -429 -17 -509 76 248 -543 -361 -302 -375 -166 -433 -341 -196 155 227 -313 -256 -248 -344 -567 -459 -426 -514 -88 351 -609 -482 -433 -456 -373 -576 -488 -321 -503 -51 -490 -430 -415 -480 -606 -574 334 -190 -520 -529 -477 -310 -489 -392 -482 -474 -387 -398 -461 -427 -490 -208 -284 -295 -506 -517 -369 -183 -459 -472 427 -467 -400 -174 -428 -115 -187 -367 -395 -405 -470 -313 -364 -248 -218 -79 116 -310 58 201 -367 -278 -180 -269 80 -324 -226 -94 -261 144 41 -145 -140 -259 -397 -304 -323 -403 -198 165 -535 -383 -263 -375 356 -422 -339 -195 -382 -98 -115 -288 -270 -374 -479 -424 334 -190 -520 -529 -477 -310 -489 -392 -482 -474 -387 -398 -461 -427 -490 -208 -284 -295 -506 -517 -22 -343 -393 -277 -486 -380 -204 -327 271 -39 -284 -185 -389 -69 275 -270 -237 -339 -412 -367 62 -224 37 32 -284 -221 -110 -204 197 -259 -159 -30 -214 144 121 53 -74 -201 -316 -226 -236 -331 -142 248 -411 -306 -198 -297 -41 -47 -259 134 -305 -53 190 -186 -180 -293 -417 -335 -35 -332 292 -191 -457 -236 -206 -418 -208 -484 -407 318 -354 -179 22 -159 -215 -420 -488 -371 -359 -324 -456 -364 -457 -427 -298 -203 366 -367 -314 -266 -447 -171 -119 -335 -294 192 -462 -413 -206 -272 -335 -333 -384 -343 -316 32 -263 -346 -316 -271 413 -221 -317 -205 -218 -289 -465 -430 -346 -239 -476 -490 -297 -498 -484 410 -403 -115 -111 -357 -482 -395 -469 -380 -252 188 -450 -373 -467 -308 -637 -629 374 -595 -420 -105 -560 170 -94 -490 -528 -435 -549 -494 -406 -230 -299 -184 -382 -257 -558 -502 -190 -528 -427 -36 -431 291 -46 -418 -442 -330 -423 -421 -303 114 -371 -358 -342 -304 -513 -597 -539 -422 -503 -512 -497 -581 -497 -337 -472 -466 -509 395 -152 -498 -552 -531 -362 -234 -614 -609 -359 -592 -625 347 -548 -221 -214 -487 -565 -538 -612 -502 -289 309 -592 -492 -305 -339 -351 -439 -512 371 -406 -458 -372 -560 -441 -245 -441 -389 -396 -297 -381 -448 -462 -479 -473 -377 -534 -591 -154 26 -296 -440 -515 -468 -438 -396 -521 -445 -514 -432 -451 -469 -275 450 0 -140 -430 -478 -422 -269 -409 -342 -378 -442 -336 -215 -345 -337 -390 358 -5 17 -464 -434 -60 -166 -376 -427 -378 -382 -345 -211 -296 -390 -219 -140 -367 -244 -332 71 395 -215 136 -416 -412 622 -547 -532 -490 -545 -493 -369 -525 -498 -394 -439 -534 -470 -501 -446 -360 -456 -581 -556 -590 -435 -506 -588 -464 -526 508 -578 -561 -567 -502 -304 -525 -290 -447 -473 -477 -577 -486 -333 -450 -294 -445 -471 -164 -438 -391 -364 -401 -295 -304 -346 -455 -339 -391 -407 -379 -363 569 -196 -412 622 -547 -532 -490 -545 -493 -369 -525 -498 -394 -439 -534 -470 -501 -446 -360 -456 -581 -556 -590 -435 -506 -588 -464 -526 508 -578 -561 -567 -502 -304 -525 -290 -447 -473 -477 -577 -486 -333 -197 -153 -437 -428 -298 -443 -377 41 -383 -208 105 -352 -384 -359 -386 -348 -175 373 -449 -429 -485 -314 -550 -581 -411 -531 -496 -219 -483 -241 528 -444 -505 -452 -556 -455 -404 -320 -368 -367 194 -474 -78 248 -559 -361 -315 -384 -174 -443 -352 -205 -331 144 -319 -260 -256 -349 -581 -475 -278 -318 -301 9 -430 -340 328 -301 232 -344 -256 -144 -343 -54 160 -217 -196 32 -392 -332 -526 -501 -235 360 -611 -528 -478 -478 -538 -632 -548 -368 -619 -334 -570 -517 -496 -538 -603 -600 -342 -304 -513 -597 -539 -422 -503 -512 -497 -581 -497 -337 -472 -466 -509 395 -152 -498 -552 -531 -413 -228 -494 -515 435 -491 -414 -228 -468 -224 -241 -402 -432 -440 -502 -356 -405 -299 -254 -113
letter-probability matrix: alength= 20 w= 50 n= 7449 E= 7.7e-351 0.001177 0.000575 0.000799 0.000651 0.010620 0.001403 0.002368 0.001223 0.000830 0.002889 0.000747 0.001100 0.000889 0.000951 0.001092 0.001319 0.001017 0.001369 0.002122 0.966858 0.003856 0.001311 0.001061 0.001716 0.007685 0.001692 0.001140 0.015312 0.001898 0.925676 0.011130 0.001250 0.001719 0.002266 0.002306 0.002313 0.003280 0.011166 0.000963 0.002260 0.004349 0.001108 0.001254 0.002622 0.006340 0.002124 0.001830 0.011432 0.011423 0.606771 0.007651 0.002142 0.001484 0.004238 0.316594 0.003009 0.003484 0.008476 0.000930 0.002739 0.011896 0.002182 0.004723 0.026366 0.002378 0.003814 0.020602 0.004690 0.031136 0.013143 0.007685 0.008964 0.005243 0.815512 0.014833 0.009507 0.007587 0.005717 0.001692 0.002328 0.055346 0.002391 0.007068 0.005851 0.006466 0.005404 0.802381 0.002874 0.004170 0.007783 0.003419 0.018312 0.003589 0.020728 0.011762 0.011634 0.007568 0.004878 0.002024 0.016351 0.750979 0.009645 0.004420 0.006551 0.004610 0.020212 0.002416 0.007936 0.006038 0.011664 0.005313 0.005013 0.003059 0.038642 0.005543 0.074016 0.014910 0.024966 0.001341 0.002726 0.010971 0.062020 0.144897 0.014472 0.010846 0.012896 0.290547 0.003382 0.011765 0.006766 0.002709 0.153592 0.004614 0.014032 0.009633 0.020650 0.011098 0.004842 0.001833 0.208435 0.006180 0.002151 0.022624 0.004173 0.003288 0.006426 0.013394 0.006401 0.007235 0.005516 0.002598 0.852453 0.003635 0.016564 0.005191 0.021627 0.010526 0.005310 0.001505 0.003203 0.007507 0.000833 0.002329 0.002772 0.001213 0.003031 0.001278 0.001681 0.003014 0.003215 0.000898 0.001827 0.952984 0.002427 0.002472 0.005202 0.003528 0.002572 0.000367 0.000849 0.023316 0.004492 0.002896 0.004049 0.004911 0.003151 0.001987 0.097958 0.003636 0.021224 0.006012 0.002666 0.003211 0.002485 0.003927 0.005234 0.013475 0.792977 0.000680 0.001713 0.008016 0.001504 0.843282 0.042477 0.002396 0.005486 0.014550 0.003552 0.004340 0.004577 0.001852 0.036957 0.002168 0.004105 0.003886 0.007974 0.004604 0.004685 0.000928 0.002661 0.004066 0.001685 0.002785 0.003040 0.014246 0.003433 0.001897 0.003142 0.003287 0.013223 0.002922 0.002854 0.002010 0.003025 0.003932 0.003667 0.003277 0.004807 0.912886 0.009816 0.020824 0.005054 0.007770 0.010654 0.168123 0.007345 0.026984 0.012898 0.010129 0.023228 0.042552 0.008356 0.006369 0.041748 0.009911 0.017688 0.010929 0.015642 0.043477 0.510319 0.023899 0.002048 0.007203 0.049888 0.003212 0.007168 0.003527 0.005212 0.009810 0.009538 0.002814 0.005488 0.777858 0.047029 0.007356 0.016272 0.010891 0.008009 0.000735 0.002042 0.004066 0.001685 0.002785 0.003040 0.014246 0.003433 0.001897 0.003142 0.003287 0.013223 0.002922 0.002854 0.002010 0.003025 0.003932 0.003667 0.003277 0.004807 0.912886 0.009816 0.019431 0.002043 0.007978 0.005715 0.001801 0.841433 0.002463 0.002487 0.005976 0.003035 0.001741 0.008892 0.003217 0.003218 0.005540 0.042801 0.034954 0.004343 0.000980 0.001951 0.081981 0.000380 0.103024 0.445538 0.001032 0.005850 0.003522 0.002911 0.016756 0.005084 0.002269 0.008057 0.138037 0.152794 0.006786 0.010441 0.008122 0.005478 0.000345 0.001593 0.004819 0.000365 0.033089 0.910891 0.000654 0.002526 0.001419 0.001659 0.003991 0.001885 0.000816 0.003391 0.001441 0.022287 0.001987 0.003129 0.002546 0.002124 0.000264 0.000715 0.934277 0.003453 0.001652 0.002034 0.001627 0.008312 0.000966 0.002595 0.001884 0.003818 0.001642 0.001989 0.001934 0.001647 0.001984 0.014593 0.006327 0.007678 0.000527 0.001062 0.007156 0.003634 0.002520 0.003030 0.854939 0.002809 0.001789 0.011703 0.002727 0.046028 0.006608 0.002463 0.003043 0.001912 0.002284 0.007040 0.003622 0.010607 0.003899 0.022185 0.205412 0.001504 0.091012 0.321456 0.003482 0.010379 0.008210 0.006065 0.092524 0.010772 0.005011 0.016336 0.007704 0.086282 0.078567 0.022518 0.017124 0.009874 0.001126 0.004640 0.009808 0.000789 0.015428 0.250339 0.001091 0.005010 0.004623 0.002918 0.625425 0.005465 0.002300 0.008101 0.003351 0.016158 0.026720 0.008375 0.006981 0.004452 0.000638 0.002027 0.934277 0.003453 0.001652 0.002034 0.001627 0.008312 0.000966 0.002595 0.001884 0.003818 0.001642 0.001989 0.001934 0.001647 0.001984 0.014593 0.006327 0.007678 0.000527 0.001062 0.079065 0.001199 0.003986 0.011708 0.001527 0.005134 0.006938 0.004063 0.347091 0.077780 0.003356 0.008739 0.003187 0.019694 0.398655 0.009448 0.008738 0.005678 0.001016 0.002996 0.141844 0.002730 0.078480 0.099845 0.006186 0.015451 0.013314 0.009525 0.207899 0.016982 0.008012 0.025587 0.010712 0.085913 0.136564 0.089193 0.027085 0.014729 0.001973 0.007977 0.017883 0.001300 0.022676 0.446666 0.002577 0.008583 0.007212 0.005002 0.040013 0.073884 0.003994 0.079459 0.005697 0.022076 0.220422 0.016994 0.013052 0.007790 0.000981 0.003739 0.072427 0.001295 0.459270 0.021189 0.001873 0.013956 0.006836 0.002159 0.012525 0.003569 0.001430 0.283770 0.004066 0.009170 0.069084 0.020390 0.010228 0.003237 0.000598 0.002928 0.007640 0.001366 0.002567 0.006406 0.001869 0.003718 0.003621 0.009597 0.669801 0.007996 0.002735 0.004957 0.002129 0.009705 0.026002 0.006021 0.005906 0.225064 0.000718 0.002182 0.022018 0.001958 0.005959 0.007940 0.003104 0.006626 0.003190 0.049040 0.008609 0.009292 0.002696 0.004814 0.825757 0.006850 0.006591 0.014885 0.010002 0.008019 0.000702 0.001946 0.008386 0.002457 0.002239 0.002667 0.005663 0.002258 0.000998 0.672589 0.003248 0.046110 0.011120 0.002639 0.001673 0.002056 0.002288 0.004418 0.007894 0.217635 0.000781 0.002878 0.003614 0.001531 0.000733 0.001021 0.592082 0.001157 0.001558 0.019006 0.001094 0.330870 0.012520 0.001049 0.001211 0.001562 0.001314 0.002008 0.002709 0.012061 0.002212 0.010687 0.006511 0.002169 0.001269 0.002459 0.011931 0.001842 0.001479 0.030533 0.002684 0.767097 0.017563 0.001728 0.002200 0.003229 0.003150 0.003323 0.005540 0.130764 0.001342 0.003188 0.008605 0.001564 0.001727 0.001270 0.001060 0.003846 0.000873 0.001124 0.001695 0.001818 0.000768 0.003028 0.001794 0.001254 0.001737 0.948784 0.015830 0.001876 0.000384 0.000961 0.007507 motif=2 starts: w=8, seq=0, l=865 starts: w=8, seq=5, l=677 starts: w=8, seq=10, l=681 starts: w=11, seq=0, l=865 starts: w=11, seq=5, l=677 starts: w=11, seq=10, l=681 starts: w=15, seq=0, l=865 starts: w=15, seq=5, l=677 starts: w=15, seq=10, l=681 starts: w=21, seq=0, l=865 starts: w=21, seq=5, l=677 starts: w=21, seq=10, l=681 starts: w=29, seq=0, l=865 starts: w=29, seq=5, l=677 starts: w=29, seq=10, l=681 starts: w=41, seq=0, l=865 starts: w=41, seq=5, l=677 starts: w=41, seq=10, l=681 starts: w=50, seq=0, l=865 starts: w=50, seq=5, l=677 starts: w=50, seq=10, l=681 em: w= 8, psites= 2, iter= 0 em: w= 8, psites= 4, iter= 0 em: w= 8, psites= 8, iter= 0 em: w= 8, psites= 12, iter= 0 em: w= 11, psites= 2, iter= 0 em: w= 11, psites= 4, iter= 0 em: w= 11, psites= 8, iter= 0 em: w= 11, psites= 12, iter= 0 em: w= 15, psites= 2, iter= 0 em: w= 15, psites= 4, iter= 0 em: w= 15, psites= 8, iter= 0 em: w= 15, psites= 12, iter= 0 em: w= 21, psites= 2, iter= 0 em: w= 21, psites= 4, iter= 0 em: w= 21, psites= 8, iter= 0 em: w= 21, psites= 12, iter= 0 em: w= 29, psites= 2, iter= 0 em: w= 29, psites= 4, iter= 0 em: w= 29, psites= 8, iter= 0 em: w= 29, psites= 12, iter= 0 em: w= 41, psites= 2, iter= 0 em: w= 41, psites= 4, iter= 0 em: w= 41, psites= 8, iter= 0 em: w= 41, psites= 12, iter= 0 em: w= 50, psites= 2, iter= 0 em: w= 50, psites= 4, iter= 0 em: w= 50, psites= 8, iter= 0 em: w= 50, psites= 12, iter= 0 0.002557 0.000859 0.001170 0.003700 0.001179 0.000374 0.435214 0.001188 0.022028 0.005468 0.001073 0.000940 0.000765 0.000850 0.001895 0.006102 0.505575 0.000291 0.001264 0.011150 0.001229 0.005337 0.003796 0.001274 0.936810 0.001712 0.001643 0.004026 0.002105 0.001130 0.005748 0.002224 0.002138 0.003795 0.007883 0.003238 0.002662 0.000716 0.001385 0.003462 0.000949 0.001494 0.001327 0.015298 0.085666 0.003669 0.001858 0.001498 0.003988 0.001159 0.002013 0.001270 0.001450 0.001678 0.003091 0.001992 0.002302 0.002617 0.863218 0.092129 0.004892 0.003083 0.002906 0.002387 0.011063 0.001680 0.003662 0.003873 0.004770 0.002339 0.007099 0.004315 0.003081 0.003967 0.735620 0.043875 0.066663 0.000709 0.001888 0.060657 0.004088 0.004491 0.004144 0.003240 0.005076 0.002620 0.009097 0.006816 0.006857 0.005264 0.011920 0.003717 0.005839 0.005918 0.100514 0.698915 0.013391 0.045299 0.002136 0.005301 0.962160 0.001365 0.001992 0.001492 0.001638 0.000936 0.003034 0.001396 0.003225 0.001571 0.001497 0.001165 0.001223 0.001836 0.002802 0.003736 0.002507 0.000314 0.000809 0.001543 0.000634 0.001822 0.001359 0.001788 0.001871 0.964981 0.000713 0.001090 0.002008 0.000740 0.003807 0.001236 0.004256 0.002681 0.002326 0.001656 0.001089 0.000607 0.003792 0.004066 0.001685 0.002785 0.003040 0.014246 0.003433 0.001897 0.003142 0.003287 0.013223 0.002922 0.002854 0.002010 0.003025 0.003932 0.003667 0.003277 0.004807 0.912886 0.009816 0.005301 0.962160 0.001365 0.001992 0.001492 0.001638 0.000936 0.003034 0.001396 0.003225 0.001571 0.001497 0.001165 0.001223 0.001836 0.002802 0.003736 0.002507 0.000314 0.000809 0.001543 0.000634 0.001822 0.001359 0.001788 0.001871 0.964981 0.000713 0.001090 0.002008 0.000740 0.003807 0.001236 0.004256 0.002681 0.002326 0.001656 0.001089 0.000607 0.003792 0.023561 0.004461 0.002928 0.004119 0.005613 0.003325 0.002087 0.052049 0.003742 0.024128 0.049941 0.002732 0.003299 0.002634 0.004076 0.005533 0.013481 0.789562 0.000784 0.001947 0.003186 0.001465 0.001339 0.001422 0.002571 0.001805 0.000918 0.008590 0.001862 0.019247 0.935892 0.001443 0.001421 0.001389 0.001257 0.002623 0.002760 0.006436 0.001371 0.003003 0.352609 0.000483 0.035245 0.446178 0.000924 0.005864 0.003211 0.002734 0.015911 0.004726 0.002092 0.007570 0.004770 0.086331 0.006484 0.010153 0.007695 0.005282 0.000314 0.001422 0.013424 0.001424 0.007532 0.084854 0.002259 0.006785 0.278245 0.004860 0.265178 0.009411 0.004077 0.011547 0.004388 0.021891 0.179494 0.013686 0.011651 0.074295 0.001166 0.003834 0.002410 0.000400 0.011890 0.964409 0.000643 0.001843 0.001040 0.001432 0.001277 0.001274 0.000540 0.002458 0.000645 0.003146 0.001143 0.001708 0.001452 0.001420 0.000270 0.000599 0.008605 0.001564 0.001727 0.001270 0.001060 0.003846 0.000873 0.001124 0.001695 0.001818 0.000768 0.003028 0.001794 0.001254 0.001737 0.948784 0.015830 0.001876 0.000384 0.000961 0.005258 0.002657 0.001971 0.002253 0.903964 0.002384 0.001617 0.008082 0.002074 0.021639 0.004525 0.001935 0.002366 0.001507 0.001823 0.005204 0.002728 0.007489 0.003031 0.017490
Time 27.00 secs.
BL MOTIF 2 width=50 seqs=11 B.subtilis ( 79) FVAIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQKPFYAGTYF 1 D.radiodaurans ( 88) FVNIKVDREERPDVDAVYMAATQALTGQGGWPMTVFLTPDAEPFYAGTYF 1 M.thermoautotrophicum ( 78) FVSVKVDREERPDIDAIYMRVCQMMTGAGGWPLTIIMTPEGEPFFAGTYF 1 A.aeolicus ( 77) FVPIKVDREERPDVDAFYMSVCQAMTGTGGWPLTIIMTPDKEPFFAGTYI 1 M.tuberculosis ( 81) FVCIKVDREERPDIDAVYMNATVALTGQGGWPMTCFLTPNGRPFFCGTYY 1 H.sapiens ( 134) FVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYF 1 A.thaliana ( 232) FVSIKVDREERPDVDKVYMSFVQALYGGGGWPLSVFLSPDLKPLMGGTYF 1 C.elegans ( 89) FVAIKVDREERPDVDKLYMAFVVASSGHGGWPMSVFLTPDLHPITGGTYF 1 A.fulgidus ( 74) FVAIKVDRDERPDIDKRYQEFVMATTGSGGWPLTVFLTPDGKPFFGGTYF 1 D.melanogaster ( 148) FVNIKVDREERPDIDKIYMQFLLMSKGSGGWPMSVWLTPTLAPLVAGTYF 1 A.pernix ( 75) FVMVKVDREERPDVDTLLMRYCAIASGSCGWPLNVLLTPDGKPFYVATYL 1 //
log-odds matrix: alength= 20 w= 50 n= 7449 bayes= 10.9361 E= 1.4e-285 -413 -228 -494 -515 435 -491 -414 -228 -468 -224 -241 -402 -432 -440 -502 -356 -405 -299 -254 -113 -293 -240 -517 -524 -398 -491 -465 -48 -476 -312 -290 -436 -461 -451 -479 -425 -270 394 -528 -503 154 237 -257 -225 -303 -235 -230 -186 -159 -279 150 211 55 -130 -230 189 -107 -177 -360 -301 -346 -239 -476 -490 -297 -498 -484 410 -403 -115 -111 -357 -482 -395 -469 -380 -252 188 -450 -373 -402 -320 -498 -474 -548 -475 -398 -358 411 -500 -397 -306 -447 -345 -80 -421 -355 -458 -455 -494 -293 -240 -517 -524 -398 -491 -465 -48 -476 -312 -290 -436 -461 -451 -479 -425 -270 394 -528 -503 -369 -324 387 -149 -436 -385 -293 -363 -379 -463 -387 -42 -457 -313 -409 -313 -347 -383 -438 -400 -488 -338 -540 -570 -556 -486 -339 -466 -231 -522 -481 -375 -452 -309 401 -449 -439 -551 -442 -513 -508 -502 -181 358 -610 -521 -470 -473 -506 -624 -538 -358 -601 -315 -557 -502 -483 -529 -603 -596 -526 -501 -235 360 -611 -528 -478 -478 -538 -632 -548 -368 -619 -334 -570 -517 -496 -538 -603 -600 -488 -338 -540 -570 -556 -486 -339 -466 -231 -522 -481 -375 -452 -309 401 -449 -439 -551 -442 -513 -362 -395 -470 -485 -520 -456 -448 -454 -414 -499 -474 -410 434 -371 -458 -356 -368 -453 -559 -549 -369 -324 387 -149 -436 -385 -293 -363 -379 -463 -387 -42 -457 -313 -409 -313 -347 -383 -438 -400 -338 -224 -600 -591 -359 -580 -591 312 -538 -232 -222 -482 -543 -525 -585 -492 -277 333 -591 -499 -369 -324 387 -149 -436 -385 -293 -363 -379 -463 -387 -42 -457 -313 -409 -313 -347 -383 -438 -400 178 -191 -267 -236 -396 -253 -238 -302 283 -367 -272 -143 -313 -127 -179 61 92 -271 -419 -354 -191 -120 -422 -388 50 -365 -300 215 -316 52 -73 -271 -346 -266 -6 -252 -136 289 -302 -261 -483 -332 -545 -560 -49 -530 -210 -295 -472 -19 -295 -365 -507 -381 -461 -423 -418 -360 -169 444 -474 -305 -541 -565 -401 -525 -486 -210 -462 -231 526 -433 -499 -176 -536 -444 -393 -311 -360 -357 62 -219 -125 30 -279 -216 -106 -200 -14 -255 -155 134 -210 143 167 121 83 -197 -312 -222 52 -115 -425 -384 318 -349 -255 123 -307 -127 -71 -254 -342 -252 -327 -228 -144 137 -235 103 -252 447 -507 -466 -242 -407 -381 19 -388 -1 -126 -332 -417 -336 -413 -295 176 251 -368 -314 -51 -148 -371 -234 -212 -353 -134 -55 -243 -35 127 -200 -317 405 -253 -222 -155 101 -285 -261 261 -131 -475 -439 -205 -318 -376 116 -374 3 245 -331 -430 -318 -394 -199 -206 -86 -342 -321 -1 -97 -369 -324 -168 -294 -251 -13 -246 118 307 -204 -309 -197 -279 123 177 -46 -263 -214 -259 -170 -331 -370 -363 -379 -309 -208 -6 -375 -213 -117 -353 -212 -290 178 368 -217 -396 20 -237 -281 -291 -378 -462 362 -352 -398 -312 -509 -380 -182 -391 -331 -339 -64 -317 -385 -413 -427 -1 -215 -139 -114 -304 88 128 -223 -48 -282 -183 -33 -234 266 -132 177 87 -218 -339 -249 -244 140 -304 -391 -471 362 -364 -408 -324 -517 -390 -196 -400 -343 -350 -239 -324 -393 -423 -437 -305 -339 -351 -439 -512 371 -406 -458 -372 -560 -441 -245 -441 -389 -396 -297 -381 -448 -462 -479 -450 -294 -445 -471 -164 -438 -391 -364 -401 -295 -304 -346 -455 -339 -391 -407 -379 -363 569 -196 -362 -395 -470 -485 -520 -456 -448 -454 -414 -499 -474 -410 434 -371 -458 -356 -368 -453 -559 -549 -473 -331 -727 -673 -176 -645 -531 -69 -597 239 403 -568 -560 -435 -568 -579 -398 -202 -382 -389 -256 -190 -249 -357 -400 -317 -297 -251 -275 -417 -257 246 -361 -232 -331 181 348 -253 -432 -407 -184 175 -424 -414 -311 -435 -366 176 -371 -225 -195 -341 -372 -351 -374 -339 -162 358 -454 -436 -408 -255 -565 -556 366 -531 -375 181 -490 9 -103 -422 -475 -399 -496 -407 -352 -210 278 -133 -392 -265 -554 -493 -171 -528 -414 97 -422 284 230 -414 -432 -314 -410 -419 -309 -160 -353 -347 -256 -170 -374 -430 -382 -388 -347 -215 -299 -396 -223 -140 -370 -247 -335 70 413 -219 -412 -421 -362 -395 -470 -485 -520 -456 -448 -454 -414 -499 -474 -410 434 -371 -458 -356 -368 -453 -559 -549 -351 -312 376 -83 -424 -360 -273 -350 -351 -450 -373 76 -439 -286 -390 -285 -134 -369 -428 -385 -10 -211 -203 -155 -289 189 -164 -166 95 136 -164 -89 -274 138 -105 -137 -122 -183 -333 -262 -12 -264 -179 143 -339 -267 131 -244 247 -295 -199 -75 -261 146 70 -129 -121 -243 -350 -270 -362 -395 -470 -485 -520 -456 -448 -454 -414 -499 -474 -410 434 -371 -458 -356 -368 -453 -559 -549 -386 -206 -493 -502 412 -495 -425 20 -456 -2 -141 -397 -422 -413 -490 -346 -368 -226 -245 -115 -205 -120 -334 -317 253 -329 -66 -71 -257 -160 124 -208 -303 -218 -275 -191 39 99 -138 307 240 249 -476 -473 -415 199 -437 -314 -428 -407 -311 -321 -376 -354 -431 -119 -186 42 -460 -463 -103 -278 -292 -379 -462 362 -353 -397 -312 -508 -379 -183 -391 -332 -338 -229 -315 -383 -413 -427 -399 -320 -515 -584 -520 -475 -485 -383 -465 -539 -402 -317 -489 -413 -490 -201 438 -386 -534 -541 -629 -449 -625 -694 -206 -567 -359 -500 -600 -514 -501 -484 -573 -506 -576 -554 -548 -544 -305 466 -365 -180 -455 -468 423 -464 -398 -71 -425 -123 -189 -364 -392 -403 -467 -309 -362 -248 -215 -12
letter-probability matrix: alength= 20 w= 50 n= 7449 E= 1.4e-285 0.005258 0.002657 0.001971 0.002253 0.903964 0.002384 0.001617 0.008082 0.002074 0.021639 0.004525 0.001935 0.002366 0.001507 0.001823 0.005204 0.002728 0.007489 0.003031 0.017490 0.012119 0.002439 0.001681 0.002115 0.002821 0.002374 0.001136 0.028176 0.001959 0.011700 0.003230 0.001532 0.001928 0.001395 0.002141 0.003245 0.006953 0.911430 0.000454 0.001171 0.266880 0.066781 0.010187 0.016743 0.005447 0.014046 0.005793 0.010768 0.017634 0.014783 0.068219 0.135602 0.068908 0.012860 0.012044 0.228171 0.021573 0.017356 0.001448 0.004755 0.008386 0.002457 0.002239 0.002667 0.005663 0.002258 0.000998 0.672589 0.003248 0.046110 0.011120 0.002639 0.001673 0.002056 0.002288 0.004418 0.007894 0.217635 0.000781 0.002878 0.005687 0.001405 0.001921 0.002977 0.000998 0.002660 0.001815 0.003270 0.920150 0.003196 0.001539 0.003766 0.002124 0.002915 0.033907 0.003337 0.003856 0.002481 0.000753 0.001245 0.012119 0.002439 0.001681 0.002115 0.002821 0.002374 0.001136 0.028176 0.001959 0.011700 0.003230 0.001532 0.001928 0.001395 0.002141 0.003245 0.006953 0.911430 0.000454 0.001171 0.007132 0.001363 0.888432 0.028371 0.002159 0.004951 0.003743 0.003163 0.003841 0.004111 0.001647 0.023440 0.001990 0.003637 0.003479 0.007044 0.004092 0.004175 0.000844 0.002388 0.003126 0.001238 0.001442 0.001536 0.000942 0.002463 0.002724 0.001553 0.010720 0.002732 0.000855 0.002341 0.002057 0.003743 0.954420 0.002737 0.002157 0.001299 0.000824 0.001090 0.002714 0.000398 0.017271 0.956856 0.000649 0.001934 0.001098 0.001481 0.001597 0.001354 0.000579 0.002620 0.000732 0.003575 0.001247 0.001895 0.001596 0.001520 0.000270 0.000616 0.002410 0.000400 0.011890 0.964409 0.000643 0.001843 0.001040 0.001432 0.001277 0.001274 0.000540 0.002458 0.000645 0.003146 0.001143 0.001708 0.001452 0.001420 0.000270 0.000599 0.003126 0.001238 0.001442 0.001536 0.000942 0.002463 0.002724 0.001553 0.010720 0.002732 0.000855 0.002341 0.002057 0.003743 0.954420 0.002737 0.002157 0.001299 0.000824 0.001090 0.007507 0.000833 0.002329 0.002772 0.001213 0.003031 0.001278 0.001681 0.003014 0.003215 0.000898 0.001827 0.952984 0.002427 0.002472 0.005202 0.003528 0.002572 0.000367 0.000849 0.007132 0.001363 0.888432 0.028371 0.002159 0.004951 0.003743 0.003163 0.003841 0.004111 0.001647 0.023440 0.001990 0.003637 0.003479 0.007044 0.004092 0.004175 0.000844 0.002388 0.008826 0.002732 0.000951 0.001328 0.003680 0.001284 0.000476 0.341999 0.001274 0.020461 0.005164 0.001115 0.001092 0.000834 0.001028 0.002029 0.006632 0.597599 0.000294 0.001203 0.007132 0.001363 0.888432 0.028371 0.002159 0.004951 0.003743 0.003163 0.003841 0.004111 0.001647 0.023440 0.001990 0.003637 0.003479 0.007044 0.004092 0.004175 0.000844 0.002388 0.316382 0.003446 0.009562 0.015501 0.002857 0.012373 0.005471 0.004823 0.377308 0.008003 0.003666 0.011617 0.005395 0.013194 0.017152 0.094090 0.085837 0.009075 0.000967 0.003281 0.024427 0.005627 0.003249 0.005428 0.063020 0.005694 0.003566 0.173728 0.005945 0.146744 0.014540 0.004787 0.004293 0.005019 0.056811 0.010736 0.017665 0.440264 0.002175 0.006282 0.003236 0.001293 0.001388 0.001646 0.031603 0.001819 0.006678 0.005072 0.002013 0.089157 0.003122 0.002501 0.001409 0.002261 0.002429 0.003281 0.002508 0.004880 0.005458 0.828248 0.003451 0.001553 0.001427 0.001586 0.002764 0.001876 0.000983 0.009160 0.002157 0.020589 0.923279 0.001561 0.001482 0.009356 0.001446 0.002831 0.002964 0.006854 0.001456 0.003225 0.141660 0.002825 0.025518 0.097954 0.006402 0.015966 0.013652 0.009788 0.048086 0.017398 0.008217 0.079245 0.010976 0.085687 0.187906 0.142681 0.080687 0.015111 0.002025 0.008216 0.131628 0.005817 0.003194 0.005558 0.402118 0.006347 0.004877 0.091825 0.006329 0.042165 0.014689 0.005398 0.004421 0.005521 0.006146 0.012703 0.016734 0.153178 0.003454 0.077897 0.016079 0.286806 0.001805 0.003148 0.008277 0.004248 0.002039 0.044591 0.003602 0.101532 0.010027 0.003139 0.002627 0.003095 0.003388 0.007956 0.153840 0.338095 0.001371 0.004334 0.064501 0.004634 0.004628 0.015755 0.010240 0.006201 0.011300 0.026723 0.009852 0.080102 0.058164 0.007847 0.005232 0.527881 0.010262 0.013210 0.015455 0.119321 0.002442 0.006251 0.562912 0.005220 0.002262 0.003798 0.010693 0.007895 0.002101 0.087554 0.003990 0.104307 0.131434 0.003169 0.002393 0.003495 0.003856 0.015480 0.010897 0.032764 0.001647 0.004133 0.091670 0.006592 0.004687 0.008448 0.013872 0.009311 0.005004 0.035818 0.009688 0.230399 0.202207 0.007640 0.005531 0.008107 0.008544 0.143989 0.154009 0.042990 0.002846 0.008647 0.015343 0.003981 0.006135 0.006128 0.003595 0.005179 0.003343 0.009305 0.051032 0.007602 0.005494 0.013942 0.004076 0.007290 0.007905 0.210753 0.580679 0.013227 0.001135 0.043856 0.017875 0.001841 0.008088 0.005800 0.001802 0.876307 0.002487 0.002479 0.006114 0.002993 0.001731 0.008899 0.003129 0.003194 0.005665 0.039460 0.0